Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 701aa    MW: 75360.1 Da    PI: 10.4228
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                      zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg..Htvv 40 
                                   r+C  ++  ++  +C++++ +lC  C  + H +  H++v 331 RRCGACGGTPAAVHCRTDGAYLCIACDAA-HARagHERV 368
                                   79***************************.977889875 PP

                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpRvKGrF+k++ 610 REARLMRYREKRKNRRFEKTIRYASRKAYAETRPRVKGRFAKRT 653
                                   9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.186328370IPR000315B-box-type zinc finger
SMARTSM003361.6E-5328370IPR000315B-box-type zinc finger
PfamPF006432.1E-5331368IPR000315B-box-type zinc finger
CDDcd000219.36E-4340370No hitNo description
PROSITE profilePS5101716.956610652IPR010402CCT domain
PfamPF062031.0E-17610652IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0963183e-51FP096318.1 Phyllostachys edulis cDNA clone: bphylf059i05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLF2DTK15e-90F2DTK1_HORVD; Predicted protein
STRINGMLOC_38289.31e-89(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.11e-21CONSTANS-like 3